Dataset · Hugging Face

cola60/OceanCorpus

Name: OceanCorpus
Creator: cola60
License: mit
Keywords: language:en, license:mit, modality:image, arxiv:2605.00877, region:us, text-generation, question-answering, instruction-tuning, pre-training, knowledge-injection, multimodal, marine, scientific-papers, wikipedia, sonar-imagery

OceanCorpus Dataset Description OceanCorpus is a large-scale, multimodal dataset designed to inject structured marine domain knowledge into Large Language Models (LLMs). It aggregates data from three primary sources to support text generation, instruction tuning, and vision-language alignment: Web Knowledge (Text-Only): A dataset of 113,626 instruction-style QA pairs extracted from Wikipedia and authoritative marine websites, available in Web/data.csv. Paper… See the full description on the dataset page: https://huggingface.co/datasets/cola60/OceanCorpus.

View on Hugging FaceReport an issue

Author / organization	cola60
License (as declared)	mit
Downloads	417 (as reported by Hugging Face)
Likes	0
Created	21 September 2026
Last updated at source	21 September 2026

text-generationquestion-answeringinstruction-tuningpre-trainingknowledge-injectionmultimodalmarinescientific-paperswikipediasonar-imagery

Embed this entry

<iframe src="https://silytics.si/embed/item/f11b4b73-6617-48dc-8d24-a4b8dd88401f" width="420" height="190" style="border:0" loading="lazy" title="Silytics entry"></iframe>

Free, no tracking. More about feeds and embeds.

More from cola60

cola60/OceanInstructionDataset

Silytics shows public metadata from Hugging Face and links to the original. Information may be incomplete or out of date. Last refreshed 16 October 2026. Licenses and terms of the original apply to the work itself. Not financial, legal or professional advice.